Image 1 of 1
Image 1 of 1
Image 1 of 1
Image 1 of 1
Semaglutide is a long-acting synthetic analog of glucagon-like peptide-1 (GLP-1) commonly used in laboratory research to investigate metabolic signaling, receptor activation, and related biochemical pathways.
Provided as a lyophilized powder with ≥98% purity verified by HPLC and mass spectrometry. Third-party COAs are available for review.
For Research Use Only. Strictly for laboratory and scientific purposes.
Molecular Formula: C₁₈₇H₂₉₁N₄₅O₅₉
CAS Number: 910463-68-2
Amino Acid Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG
(Note: Sequence includes chemical modifications to enhance half-life and receptor binding)
Synonyms: GLP-1(7-37) analog, NN9535,Molar Mass: ~4113.58 g/mol
Recommended Storage:
Lyophilized powder: Store at -20°C or lower for long-term stability
Reconstituted solution: Store at 2–8°C for 30-60 days. Avoid repeated freeze-thaw cycles and exposure to strong light.
Semaglutide is a long-acting synthetic analog of glucagon-like peptide-1 (GLP-1) commonly used in laboratory research to investigate metabolic signaling, receptor activation, and related biochemical pathways.
Provided as a lyophilized powder with ≥98% purity verified by HPLC and mass spectrometry. Third-party COAs are available for review.
For Research Use Only. Strictly for laboratory and scientific purposes.
Molecular Formula: C₁₈₇H₂₉₁N₄₅O₅₉
CAS Number: 910463-68-2
Amino Acid Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG
(Note: Sequence includes chemical modifications to enhance half-life and receptor binding)
Synonyms: GLP-1(7-37) analog, NN9535,Molar Mass: ~4113.58 g/mol
Recommended Storage:
Lyophilized powder: Store at -20°C or lower for long-term stability
Reconstituted solution: Store at 2–8°C for 30-60 days. Avoid repeated freeze-thaw cycles and exposure to strong light.