engineered for discovery
PEPTIDES
NAD+ is a high-purity research compound supplied as a lyophilized powder in a sterile vial. Researchers commonly study NAD+ for its central role in cellular energy pathways and metabolic processes in laboratory settings.
Each batch is tested via HPLC for identity and quantity, with third-party COAs available for verification.
For Research Use Only. Not for human consumption or therapeutic use.
Contents: 500/ 1000 mg lyophilized (freeze-dried) powder provided in a 10 ml vial, sealed and sterile. Purity exceeds 99%, guaranteed.
Notes: Requires reconstitution with bacteriostatic water. (Sold Here: BAC Water.)
Chemical Formula: C21H27N7O14P2
PubChem CID: 5892
CAS Number: 53-84-9
Molecular Weight: 663.43 g/mol
Storage: Store at ≤8°C, sealed, away from heat, light, and moisture. The colder the better.
Purity: >99%
Semaglutide is a long-acting synthetic analog of glucagon-like peptide-1 (GLP-1) commonly used in laboratory research to investigate metabolic signaling, receptor activation, and related biochemical pathways.
Provided as a lyophilized powder with ≥98% purity verified by HPLC and mass spectrometry. Third-party COAs are available for review.
For Research Use Only. Strictly for laboratory and scientific purposes.
Molecular Formula: C₁₈₇H₂₉₁N₄₅O₅₉
CAS Number: 910463-68-2
Amino Acid Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG
(Note: Sequence includes chemical modifications to enhance half-life and receptor binding)
Synonyms: GLP-1(7-37) analog, NN9535,Molar Mass: ~4113.58 g/mol
Recommended Storage:
Lyophilized powder: Store at -20°C or lower for long-term stability
Reconstituted solution: Store at 2–8°C for 30-60 days. Avoid repeated freeze-thaw cycles and exposure to strong light.
Tirzepatide is a dual incretin mimetic peptide studied in preclinical and laboratory research for its role in glucose-dependent insulinotropic polypeptide (GIP) and glucagon-like peptide-1 (GLP-1) receptor signaling. Scientists examine its impact on metabolic regulation and related cellular mechanisms.
High-purity lyophilized powder supplied with independent testing documentation.
For Research Use Only. Not intended for human consumption or any medical application.
Molecular Formula: C225H348N48O68
CAS Number: 2023788-19-2
Amino Acid Sequence:
39 amino acid linear synthetic peptide conjugated to a C20 fatty diacid moiety
Note: The full sequence includes proprietary modifications to enhance half-life and receptor activity.
Synonyms:
LY3298176
Dual GIP/GLP-1 receptor agonist
Tirz acetate (research form)
Molar Mass: 4813.5 Da (may vary slightly depending on salt form)
Storage Recommendations:
Store lyophilized peptide between 36°F and 46°F (2°C and 8°C) in a dry, sealed container. If storing long-term (months to 1-2 years), store below 0°C.
Do not freeze the compounded form of tirz to avoid damaging it
Reconstituted solutions should be stored at 2–8°C and used within a limited timeframe, depending on solvent and laboratory conditions.
Avoid repeated freeze-thaw cycles to maintain peptide integrity.
The GLOW blend combines GHK-Cu, BPC-157, and TB-500 — three peptides commonly studied together in models of tissue repair, angiogenesis, extracellular matrix remodeling, and cellular resilience. Researchers use this formulation to explore synergistic effects on healing and recovery processes.
High-purity components with batch-specific COAs available.
For Research Use Only. Not for human or veterinary use.
Contents: 70 mg lyophilized (freeze-dried) powder provided in a 3 ml vial, sealed and sterile. Purity exceeds 99%, guaranteed.
Notes: Requires reconstitution with bacteriostatic water.
Research peptides represent a diverse class of bioactive compounds consisting of short chains of amino acids that serve as valuable tools for scientific investigation across multiple disciplines. These synthetic or naturally-derived molecules are utilized extensively in laboratory settings to advance our understanding of cellular mechanisms, protein interactions, and biochemical pathways. Academic institutions and research facilities employ these compounds to conduct controlled studies examining receptor binding affinities, enzymatic activities, and molecular signaling cascades in vitro and in animal models. The peptides are manufactured under strict quality control protocols and are distributed exclusively to qualified research institutions with appropriate laboratory facilities and trained personnel. All research peptide products are clearly labeled for laboratory research applications only and are not approved, evaluated, or intended for human consumption, therapeutic use, or any clinical applications. These compounds serve as essential research tools that contribute to the advancement of scientific knowledge in fields such as biochemistry, pharmacology, and molecular biology through rigorous peer-reviewed studies conducted in accredited research environments.